DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15756 and Cpr12A

DIOPT Version :9

Sequence 1:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:152 Identity:50/152 - (32%)
Similarity:69/152 - (45%) Gaps:24/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VVVVQKPSHTETSPRLVDSFDQRSLDGQYEFRYQLDNGNTRYERAYWLPVGKDLVLAKKGYYSVP 144
            ::..|:...:..|.||:|.||.|..||.||:|::||:|..||||.|::.:.....|...|||:..
  Fly    18 LISAQQIKESAPSARLLDRFDNRYPDGSYEYRFELDDGTARYERGYFVKINDVKTLMVVGYYAYR 82

  Fly   145 LPNDKYSTVFYTADHRGYHVDMQTLSVEQPLLPRSLEVPGVER---------------------- 187
            :.:.:|.||||.||..||..:......|.|.||||:|||.|..                      
  Fly    83 MTDGRYITVFYNADQFGYRQNQSITPQEYPNLPRSIEVPMVSEASAASAASDGVSSSQFQSQFQS 147

  Fly   188 --DVGSGMGMGTGIATGTGTKR 207
              |......:.|....|.||.|
  Fly   148 RLDAHGNPSITTTTPRGAGTNR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:278791 22/53 (42%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:278791 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016689
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.