DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15754 and Cpr100A

DIOPT Version :10

Sequence 1:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster


Alignment Length:202 Identity:50/202 - (24%)
Similarity:66/202 - (32%) Gaps:80/202 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 AAARSQ-FATDPDQG---QEEESPDQDGEAEEAEEEEEDEEEQEEA---------------TPQ- 152
            |.|.|| :..||...   .|:.....||:...|.|:|:....:||.               |.| 
  Fly    12 ALASSQHYHQDPKTAAIISEQRYLSGDGKFGAAYEQEDGINFKEETDADGTRHGSYSYLDPTGQR 76

  Fly   153 -------------------PQPLPPALPQPGGVLEELAGGQVDEEL--EDYNA--------WRDN 188
                               || .|||.|||    ...||.|..::.  :.|.|        :|.|
  Fly    77 RTISYTAGKNGFQASGDHLPQ-APPAPPQP----VPTAGYQPQQQYQPQQYQAPAPQPQASFRSN 136

  Fly   189 FYELNEDGSYIFGYSIPHGIRRWEKGYYSEEQHGRVVEGFYVQPRHDSQGLRYELRCYR-ADSEG 252
            .|  .:||||...|:.|.         :.:.|..      |.||....|        || |....
  Fly   137 DY--GDDGSYDPRYNDPS---------FGQNQQS------YQQPAAQPQ--------YRPAPQPA 176

  Fly   253 YQPRPVE 259
            |.|:||:
  Fly   177 YNPQPVQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15754NP_572894.1 None
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:459790 7/43 (16%)

Return to query results.
Submit another query.