DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15754 and Lcp65Ad

DIOPT Version :10

Sequence 1:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster


Alignment Length:112 Identity:30/112 - (26%)
Similarity:41/112 - (36%) Gaps:32/112 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 PPALPQPGGVLEELAGGQVDEELEDYNAWRDNFYELNEDGSYIFGYSIPHGIRRWEKGYYSE--- 218
            |||:.|...||      :.|.::            |.|  .|.|......|....|:|...:   
  Fly    20 PPAIQQDAQVL------RFDSDV------------LPE--GYKFAVETSDGKSHQEEGQLKDVGT 64

  Fly   219 EQHGRVVEGFYVQPRHDSQGLRYELRCYRADSEGYQ------PRPVE 259
            :....||.|.|.....|.|  .|.:: |.||..|:|      ||||:
  Fly    65 DHEAIVVRGSYAYVGDDGQ--TYSIQ-YLADENGFQPEGAHLPRPVQ 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15754NP_572894.1 None
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 15/57 (26%)

Return to query results.
Submit another query.