DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15754 and Cpr49Ab

DIOPT Version :9

Sequence 1:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:130 Identity:38/130 - (29%)
Similarity:48/130 - (36%) Gaps:28/130 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 ATPQPQP---LPPALPQPGGVLEELAGGQVDEELEDYNAWRDNFYELNEDGSYIFGYSIPHGIRR 210
            |.|||:|   .|||:..|...|.:..|..     |..|.|.   ....||...:.||   |.:..
  Fly   125 ARPQPRPTTAAPPAIADPTANLPKGRGTG-----EGGNGWA---IIRQEDDVEVDGY---HYLWE 178

  Fly   211 WEKGYYSEEQHGRV----------VEGFYVQPRHDSQGLRYELRCYRADSEGYQPRPVEFLRTPP 265
            .|.|...||. ||:          .:|||.....|  |:.|.:. |.||..|:.|........||
  Fly   179 TENGILGEES-GRIEKLTEEEGLRSKGFYEYTGPD--GILYRVD-YVADDNGFVPSAAHLPTAPP 239

  Fly   266  265
              Fly   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15754NP_572894.1 None
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 17/60 (28%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.