DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15754 and Cpr49Ab

DIOPT Version :10

Sequence 1:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:130 Identity:38/130 - (29%)
Similarity:48/130 - (36%) Gaps:28/130 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 ATPQPQP---LPPALPQPGGVLEELAGGQVDEELEDYNAWRDNFYELNEDGSYIFGYSIPHGIRR 210
            |.|||:|   .|||:..|...|.:..|..     |..|.|.   ....||...:.||   |.:..
  Fly   125 ARPQPRPTTAAPPAIADPTANLPKGRGTG-----EGGNGWA---IIRQEDDVEVDGY---HYLWE 178

  Fly   211 WEKGYYSEEQHGRV----------VEGFYVQPRHDSQGLRYELRCYRADSEGYQPRPVEFLRTPP 265
            .|.|...||. ||:          .:|||.....|  |:.|.:. |.||..|:.|........||
  Fly   179 TENGILGEES-GRIEKLTEEEGLRSKGFYEYTGPD--GILYRVD-YVADDNGFVPSAAHLPTAPP 239

  Fly   266  265
              Fly   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15754NP_572894.1 None
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 17/60 (28%)

Return to query results.
Submit another query.