DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15754 and Cpr47Ee

DIOPT Version :10

Sequence 1:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster


Alignment Length:205 Identity:50/205 - (24%)
Similarity:67/205 - (32%) Gaps:67/205 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PFTRRQPAIASPSSGAAARSQFATDPDQGQEEESPDQDGEAEEAEEEEEDEEEQEEATP-QPQPL 156
            ||.||||                 :|.|||                         ...| |..||
  Fly    55 PFQRRQP-----------------NPVQGQ-------------------------GLFPGQRNPL 77

  Fly   157 PPALPQPGGVLEELAGGQVDEELEDYNAWRDNFY--------ELNEDGSYIFGYSIPHGIRRWEK 213
            .|..|       .|.|..:......||.::...|        |||.|||:.:|||...|.....:
  Fly    78 NPLAP-------PLTGAALQNPYTRYNQYQQQNYVPITAYQNELNLDGSFSYGYSSADGTTAQAQ 135

  Fly   214 GY-----YSEEQHGRVVEG--FYVQPRHDSQGLRY--ELRCYRADSEGYQPRPVEFLRTPPIVRR 269
            ||     |.|....:|::|  .|..|......:||  :...:||:..|....|..|....|..:.
  Fly   136 GYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTGIPSSPQYFAGAQPYQQG 200

  Fly   270 DAIPRVNCFQ 279
            ...|.:|.:|
  Fly   201 LLNPNLNPYQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15754NP_572894.1 None
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:459790 14/56 (25%)

Return to query results.
Submit another query.