DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15754 and Pcp

DIOPT Version :10

Sequence 1:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:120 Identity:29/120 - (24%)
Similarity:45/120 - (37%) Gaps:25/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 VLEELAGGQVDEELEDYNAWRDNFYELNEDGSYIFGYSIPHGIRRWEKGYYSEEQHGRVVEG--F 228
            ||:..||.....:.:.......|..::..||.|.:.|...:||...::|.     .|..|:|  .
  Fly    13 VLQVQAGSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEGL-----GGVAVQGGSS 72

  Fly   229 YVQPRHDSQGLRYELRCYRADSEGYQP-------------RPVEFLRTPPIVRRD 270
            |..|..:...:.|.     ||..||.|             |.:|::||.|...:|
  Fly    73 YTSPEGEVISVNYV-----ADEFGYHPVGAHIPQVPDYILRSLEYIRTHPYQIKD 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15754NP_572894.1 None
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790 13/56 (23%)

Return to query results.
Submit another query.