DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34324 and Gasp

Sequence 1:NP_001096972.1 Gene:CG34324 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649611.2 Gene:Gasp FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster

Alignment Length:71 Identity:18/72 (25%)
Similarity:29/72 (40%) Gaps:4/72 (6%)


  Fly   197 VAIAQVLISRHDCRGQEDGTFLADVRHCRRYYVCNRQRSKRQNCPNGYWFDRELKACRLASTVNN 261
            ||:....:::...:..:|..|......|.:|:.|:...|:.:.|.||..||    |........|
  Fly     9 VALFGAAVAQSSFKCPDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFD----ATDSKYLTEN 69

  Fly   262 CDARRN 267
            ||...|
  Fly    70 CDYLHN 75

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34324NP_001096972.1 CBM_14 209..262 CDD:279884 13/53 (25%)
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 15/55 (27%)
CBM_14 98..144 CDD:279884
CBM_14 170..218 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23301
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.