DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT4 and eef1e1

Sequence 1:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_692806.3 Gene:eef1e1 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio

Alignment Length:162 Identity:36/163 (22%)
Similarity:63/163 (39%) Gaps:45/163 (28%)


  Fly    55 RKLPAI-TDHGYQLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQ 118
            :|:|.: .::|..|:..|.|..||.:|...||      .||    |:           |......
Zfish    27 KKVPVLQNNNGPALTGLVTIACHLVKEAKRPE------LLG----DD-----------AEQRAVV 70

  Fly   119 QKWLVPYLQKTRPADNAVNLASKQLEHTLNEF--EQLFLNSRKFMMGDNISYADL-SAICEIDQP 180
            |:||...:.|   .||......|.:...||.:  ::::|....|.:.|.:.|..: ..|.|:   
Zfish    71 QQWLEHRITK---LDNCSKEEVKVILKDLNRYLEDKVYLAGNVFTLADILMYYGIHHIIVEL--- 129

  Fly   181 KSIGYNAFQNRN---KLARWYETVREELGPHY 209
                  |.|.:.   .::||::.::     ||
Zfish   130 ------AIQEKECYLNVSRWFDHIQ-----HY 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GstA 5..203 CDD:223698 34/155 (22%)
GST_N_Theta 5..80 CDD:239348 8/26 (31%)
GST_C_Theta 95..220 CDD:198292 23/122 (19%)
eef1e1XP_692806.3 GST_C_AIMP3 64..161 CDD:198338 22/105 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.