DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT4 and Gstt3

Sequence 1:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001131115.1 Gene:Gstt3 RGDID:1562732 Length:210 Species:Rattus norvegicus

Alignment Length:123 Identity:51/124 (41%)
Similarity:74/124 (60%) Gaps:6/124 (5%)


  Fly     5 LKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSE 69
            |:.|.|.::|..||:||..:.:.|||:...|.:|||:|.|..|. .||..||:||:.|..:.|:|
  Rat    60 LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFA-QVNPLRKVPALKDGDFVLAE 123

  Fly    70 NVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQK-----WL 122
            :|||..:|:|:...|:||||:....|:|:|||||||.|.:....:....||     ||
  Rat   124 SVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKVTCQCWL 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GstA 5..203 CDD:223698 51/124 (41%)
GST_N_Theta 5..80 CDD:239348 32/75 (43%)
GST_C_Theta 95..220 CDD:198292 14/34 (41%)
Gstt3NP_001131115.1 GST_N_Theta 60..135 CDD:239348 32/76 (42%)
GST_C_family 149..>175 CDD:295467 12/26 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 1 1.000 T131123
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43917
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.