DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT4 and gstt1

Sequence 1:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_002931957.2 Gene:gstt1 ID: Length:244 Species:Xenopus tropicalis

Alignment Length:209 Identity:86/210 (41%)
Similarity:120/210 (57%) Gaps:7/210 (3%)


  Fly     2 SQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQ 66
            |..|..|.|.|:|..|::||..:|::|||....:.:|||||||.|| ..|:...|:||:.|..:.
 Frog     3 SSELTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKGEHLTQEF-GKVSVLHKVPALKDGNFT 66

  Fly    67 LSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVP-YLQKTR 130
            ::|:.|:..:|||:...|.||||.....|:|:|||||||.||.....::.|..|.:.| .|.|..
 Frog    67 MAESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTILGKEV 131

  Fly   131 PADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLA 195
            |::. :|....:...|:|.||:.||.::.|:.||.||.|||.||.||.|..:.|.|.|:.|.||.
 Frog   132 PSEK-MNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVFEERPKLG 195

  Fly   196 RW----YETVREEL 205
            .|    .|.|.|||
 Frog   196 SWKQRLVEAVGEEL 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GstA 5..203 CDD:223698 82/203 (40%)
GST_N_Theta 5..80 CDD:239348 31/75 (41%)
GST_C_Theta 95..220 CDD:198292 49/117 (42%)
gstt1XP_002931957.2 GstA 6..204 CDD:223698 81/200 (41%)
GST_N_Theta 6..81 CDD:239348 31/76 (41%)
GST_C_Theta 94..220 CDD:198292 49/118 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C183536830
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H133944
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.