DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT4 and GstD3

Sequence 1:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster

Alignment Length:188 Identity:40/189 (21%)
Similarity:87/189 (46%) Gaps:12/189 (6%)


  Fly    24 EASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAREKLVPEHWY 88
            :|..:.|....|:.||||.:..:| ..:|....:|.:.|:|:.:.|:.||..:|..:....:..|
  Fly     4 KALGLEFNKKIINTLKGEQMNPDF-IKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALY 67

  Fly    89 PRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQL 153
            |:....::.|::.|.:....|......|:.:.:..........        .|:::.|. :|...
  Fly    68 PKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEED--------YKKVQETF-DFLNT 123

  Fly   154 FLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNKLARWYETVREELGPHYKE 211
            ||..:.::.||..:.||::.:..:.....:|::..:..| :||||:.|: ::.|.::|
  Fly   124 FLEGQDYVAGDQYTVADIAILANVSNFDVVGFDISKYPN-VARWYDHVK-KITPGWEE 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GstA 5..203 CDD:223698 38/179 (21%)
GST_N_Theta 5..80 CDD:239348 16/56 (29%)
GST_C_Theta 95..220 CDD:198292 22/118 (19%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 16/55 (29%)
GstA 6..173 CDD:223698 37/179 (21%)
GST_C_Delta_Epsilon 72..188 CDD:198287 22/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91154633
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D518126at33208
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.