DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT4 and GstE11

Sequence 1:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster

Alignment Length:245 Identity:58/246 (24%)
Similarity:103/246 (42%) Gaps:40/246 (16%)


  Fly     2 SQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQ 66
            ::|:.:|.. .:...||:.:...|..:..:...:::..|||.:.||. .:|....:|.:.|:|..
  Fly     3 AKPILYYAP-RSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFL-KLNAQHTIPVLDDNGTI 65

  Fly    67 LSENVAIFRHLAREKLVPE---HWYPRRHLGRSRIDEYLAWQ------QTNMGVATTEYFQQKWL 122
            :|::..|..:|| :|..||   ..||:....|..:|..|.:.      :....|....||....:
  Fly    66 VSDSHIICSYLA-DKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEV 129

  Fly   123 ----VPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSI 183
                |.||||          |...|||.|.|.:        :::||.::.||||.|..:...::.
  Fly   130 PSDRVAYLQK----------AYDGLEHCLAEGD--------YLVGDKLTIADLSCIASVSTAEAF 176

  Fly   184 GYNAFQNRNKLARWYETVREELGPHY----KEVLGEFEAKLKGSGSGQQQ 229
            .........:|.:|.:  |.:..|:|    :|.|......:||..:.:||
  Fly   177 APIEPDQFPRLVQWVK--RIQALPYYQKNNQEGLDMLVGLVKGLLAERQQ 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GstA 5..203 CDD:223698 49/211 (23%)
GST_N_Theta 5..80 CDD:239348 17/75 (23%)
GST_C_Theta 95..220 CDD:198292 31/139 (22%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 50/216 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 18/76 (24%)
GST_C_Delta_Epsilon 94..211 CDD:198287 31/137 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91082920
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.