DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT4 and GstE8

Sequence 1:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster

Alignment Length:213 Identity:59/214 (28%)
Similarity:94/214 (44%) Gaps:38/214 (18%)


  Fly    17 RALYILLEASKIPFEAIPISMLKGEHLTGEF-RDNVNRFRKLPAITDHGYQLSENVAIFRHLARE 80
            ||..:.|.|..||:|.:.|:.|..|.|:.|| |.|..  ..:|.:.|.|:.:.::.||..:|..:
  Fly    16 RAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQ--HTVPTLEDDGHFIWDSHAISAYLVSK 78

  Fly    81 KLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQ--QKWLVPYLQKTRPAD--NAVNLASK 141
            ....:..||:..|.|:.:|:.|.::.   ||......:  .|.|....|.|.|.:  :||     
  Fly    79 YGQSDTLYPKDLLQRAVVDQRLHFES---GVVFVNGLRGITKPLFATGQTTIPKERYDAV----- 135

  Fly   142 QLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICE---------IDQPKSIGYNAFQNRNKLARW 197
             :|  :.:|.:.||....|:.||.::.||.|.|..         ||..|.....|         |
  Fly   136 -IE--IYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITA---------W 188

  Fly   198 YETVREELGPHYKEVLGE 215
            .:.: ||| |:|:|..|:
  Fly   189 IKRI-EEL-PYYEEACGK 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GstA 5..203 CDD:223698 52/200 (26%)
GST_N_Theta 5..80 CDD:239348 21/64 (33%)
GST_C_Theta 95..220 CDD:198292 35/135 (26%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 55/204 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/63 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91083031
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.