DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT4 and GstE2

Sequence 1:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster

Alignment Length:225 Identity:53/226 (23%)
Similarity:97/226 (43%) Gaps:39/226 (17%)


  Fly     1 MSQPLKFYFDFLNQSSRALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGY 65
            ||..|..|...::...||..:.|.|..:.:|...:.:|.|:|....|... |....:|.:.|:|.
  Fly     1 MSDKLVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKK-NPQHTVPLLEDNGA 64

  Fly    66 QLSENVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNM-----GVATTEYFQQKWLVPY 125
            .:.::.||..:|..:....:..|||..:.|:::|:.|.:..:.:     .|:...:.:|..||| 
  Fly    65 LIWDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVP- 128

  Fly   126 LQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYAD---------LSAICEIDQPK 181
               ....|| :..|...||:        ||....::.|..::.||         |:|:.::|:.|
  Fly   129 ---KEKVDN-IKDAYGHLEN--------FLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELK 181

  Fly   182 SIGYNAFQNRNKLARWYETVREELGPHYKE 211
                     ..|:|.|:|.:.:.  |||:|
  Fly   182 ---------YPKVAAWFERLSKL--PHYEE 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GstA 5..203 CDD:223698 47/212 (22%)
GST_N_Theta 5..80 CDD:239348 18/75 (24%)
GST_C_Theta 95..220 CDD:198292 30/132 (23%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 47/216 (22%)
GST_N_Delta_Epsilon 5..78 CDD:239343 18/74 (24%)
GST_C_Delta_Epsilon 94..209 CDD:198287 30/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91083121
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.