DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT4 and mars

Sequence 1:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_956370.1 Gene:mars ZFINID:ZDB-GENE-030219-83 Length:922 Species:Danio rerio

Alignment Length:157 Identity:33/158 (21%)
Similarity:59/158 (37%) Gaps:41/158 (26%)


  Fly    73 IFRHLAREKLVPEHWYP---------RRHL--------------GRSRID---EYLAWQQTNMGV 111
            :.:|  .||:||...:|         .:||              |:...|   ::|.|:.||:..
Zfish    30 LVKH--EEKVVPYLTHPVLPILQLPSGQHLFSPNSICQYLFDVSGQKATDATNQWLEWEATNLQP 92

  Fly   112 ATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICE 176
            |..:..|   ||....|...|...:......||.:|::.:..||......:.|.:.:|.|..:  
Zfish    93 AVLQSLQ---LVALQGKRVEAAAVMKEPLSWLEQSLSKRKTSFLTDEVVSVADVVLWAALYPL-- 152

  Fly   177 IDQPKSIGYNAFQ--NRNKLARWYETV 201
                  :..:||:  :...:..|:|.|
Zfish   153 ------LSDSAFEPGDLQAVRGWFERV 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GstA 5..203 CDD:223698 33/158 (21%)
GST_N_Theta 5..80 CDD:239348 1/7 (14%)
GST_C_Theta 95..220 CDD:198292 24/113 (21%)
marsNP_956370.1 GstA 1..173 CDD:223698 32/156 (21%)
GST_N_family 1..67 CDD:238319 8/39 (21%)
GST_C_MetRS_N 75..176 CDD:198340 24/111 (22%)
PRK12268 261..820 CDD:237029
MetRS_core 263..631 CDD:173907
Anticodon_Ia_Met 640..769 CDD:153411
MetRS_RNA 866..910 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.