DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT4 and gst1

Sequence 1:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe

Alignment Length:139 Identity:36/140 (26%)
Similarity:63/140 (45%) Gaps:18/140 (13%)


  Fly    41 EHLTGEFRDNVNRFRKLPAITDH---GYQLSENVAIFRHLAREKLVPEH--WYPRRHLGRSRIDE 100
            |||.      :|...::|.:.||   .|.:.|:.||..:|| :|...|.  ..||.|....::.:
pombe    45 EHLA------LNPNGRVPTLIDHHNNDYTIWESDAILIYLA-DKYDTERKISLPRDHPEYYKVIQ 102

  Fly   101 YLAWQQTNMGVATTEYFQQKWLVPYLQKTRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDN 165
            ||.:|.:..|:.   :.|..|...|.|:.  ..:|:.....:::..|...|.: |..|.:::.:.
pombe   103 YLFFQASGQGII---WGQAGWFSVYHQEL--VISAITRYRNEIKRVLGVLEDI-LKDRDYLVANR 161

  Fly   166 ISYADLSAI 174
            .:.||||.|
pombe   162 FTIADLSFI 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GstA 5..203 CDD:223698 36/140 (26%)
GST_N_Theta 5..80 CDD:239348 13/42 (31%)
GST_C_Theta 95..220 CDD:198292 18/81 (22%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 14/46 (30%)
GstA 5..218 CDD:223698 36/140 (26%)
GST_C_Ure2p 96..219 CDD:198326 18/82 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.