DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstT4 and LOC103694879

Sequence 1:NP_572886.2 Gene:GstT4 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_008772070.1 Gene:LOC103694879 RGDID:9196693 Length:189 Species:Rattus norvegicus

Alignment Length:164 Identity:48/165 (29%)
Similarity:72/165 (44%) Gaps:21/165 (13%)


  Fly    70 NVAIFRHLAREKLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYL------QK 128
            :.||..:|:.:..|.:||||.....|:::.|||.|...|:..........|.|.|.:      :|
  Rat    12 STAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIGVQVPEEK 76

  Fly   129 TRPADNAVNLASKQLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICEIDQPKSIGYNAFQNRNK 193
            .....|::.||       |...|..||..|.|:.|..::.|||.::.|:.||.::|.|.|:.|.:
  Rat    77 VERNRNSMVLA-------LQRLEDKFLRDRAFIAGQQVTLADLMSLEELIQPVALGCNLFEGRPQ 134

  Fly   194 LARWYETVREELGPH--------YKEVLGEFEAK 219
            |..|.|.|...||..        ...|||:...|
  Rat   135 LTAWRERVEAFLGAELCQEAHNPIMSVLGQAAKK 168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstT4NP_572886.2 GstA 5..203 CDD:223698 42/139 (30%)
GST_N_Theta 5..80 CDD:239348 3/10 (30%)
GST_C_Theta 95..220 CDD:198292 40/140 (29%)
LOC103694879XP_008772070.1 GstA <12..155 CDD:223698 44/150 (29%)
GST_C_Theta 36..161 CDD:198292 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43917
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.