DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim9a and TIM9

Sequence 1:NP_001285208.1 Gene:Tim9a FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_010894.1 Gene:TIM9 SGDID:S000007256 Length:87 Species:Saccharomyces cerevisiae

Alignment Length:76 Identity:34/77 (44%)
Similarity:47/77 (61%) Gaps:7/77 (9%)


  Fly    19 KTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHE 83
            |...||:..|:.|.|.|||||:.||||..:.:.|:.|.:.|.||:||.::||.|||||      :
Yeast    19 KQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCSEKFLKHSERVGQRFQE------Q 77

  Fly    84 NALAMAQKTGK 94
            || |:.|..|:
Yeast    78 NA-ALGQGLGR 87

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 26/55 (47%)
TIM9NP_010894.1 zf-Tim10_DDP 13..74 CDD:308549 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3479
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I1673
Isobase 1 0.950 0.861654 Normalized mean entropy S713
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003354
OrthoInspector 1 1.000 T1136804
orthoMCL 1 0.900 OOG5_129185
Panther 1 1.100 LDO PTHR13172
Phylome 1 0.910 0.880 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1524
TreeFam 1 0.960
1211.810

Return to query results.
Submit another query.