DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and TIM9

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_010894.1 Gene:TIM9 / 856693 SGDID:S000007256 Length:87 Species:Saccharomyces cerevisiae


Alignment Length:76 Identity:34/76 - (44%)
Similarity:47/76 - (61%) Gaps:7/76 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHE 83
            |...||:..|:.|.|.|||||:.||||..:.:.|:.|.:.|.||:||.::||.|||||      :
Yeast    19 KQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCSEKFLKHSERVGQRFQE------Q 77

  Fly    84 NALAMAQKTGK 94
            || |:.|..|:
Yeast    78 NA-ALGQGLGR 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 25/54 (46%)
TIM9NP_010894.1 zf-Tim10_DDP 13..74 CDD:397210 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I2268
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I1696
Isobase 1 0.950 - 0.861654 Normalized mean entropy S713
OMA 1 1.010 - - QHG57731
OrthoFinder 1 1.000 - - FOG0003905
OrthoInspector 1 1.000 - - oto100208
orthoMCL 1 0.900 - - OOG6_103037
Panther 1 1.100 - - LDO PTHR13172
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1524
SonicParanoid 1 1.000 - - X3208
TreeFam 1 0.960 - -
1413.810

Return to query results.
Submit another query.