powered by:
Protein Alignment Tim9a and Timm10b
DIOPT Version :9
Sequence 1: | NP_001285208.1 |
Gene: | Tim9a / 32294 |
FlyBaseID: | FBgn0030480 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001376161.1 |
Gene: | Timm10b / 84384 |
RGDID: | 71097 |
Length: | 100 |
Species: | Rattus norvegicus |
Alignment Length: | 56 |
Identity: | 18/56 - (32%) |
Similarity: | 30/56 - (53%) |
Gaps: | 0/56 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 KDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRV 70
:.|::...|||:.||:::|.||..|:.....|.:...||.|..:|..|.:..|.|:
Rat 5 QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRL 60
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1627953at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.