DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and Timm10b

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001376161.1 Gene:Timm10b / 84384 RGDID:71097 Length:100 Species:Rattus norvegicus


Alignment Length:56 Identity:18/56 - (32%)
Similarity:30/56 - (53%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRV 70
            :.|::...|||:.||:::|.||..|:.....|.:...||.|..:|..|.:..|.|:
  Rat     5 QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRL 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 18/54 (33%)
Timm10bNP_001376161.1 zf-Tim10_DDP 3..64 CDD:397210 18/56 (32%)
Twin CX3C motif 25..49 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1627953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.