DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and TIM9

DIOPT Version :10

Sequence 1:NP_572881.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_190240.1 Gene:TIM9 / 823809 AraportID:AT3G46560 Length:93 Species:Arabidopsis thaliana


Alignment Length:76 Identity:32/76 - (42%)
Similarity:42/76 - (55%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRF 74
            ||||   |::   |.|..||.|.|.||.||:..||.:.::..||.|.:.|.||:||...||..||
plant    24 IDQL---QLR---DSLRMYNSLVERCFVDCVDSFTRKSLQKQEETCVMRCAEKFLKHTMRVGMRF 82

  Fly    75 QEFQVIAHENA 85
            .|.    ::||
plant    83 AEL----NQNA 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_572881.1 zf-Tim10_DDP 17..76 CDD:460764 25/58 (43%)
TIM9NP_190240.1 zf-Tim10_DDP 23..84 CDD:460764 29/65 (45%)

Return to query results.
Submit another query.