DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim9a and TIM9

Sequence 1:NP_001285208.1 Gene:Tim9a FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_190240.1 Gene:TIM9 AraportID:AT3G46560 Length:93 Species:Arabidopsis thaliana

Alignment Length:76 Identity:32/77 (42%)
Similarity:42/77 (55%) Gaps:10/77 (13%)


  Fly    10 IDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRF 74
            ||||   |::   |.|..||.|.|.||.||:..||.:.::..||.|.:.|.||:||...||..||
plant    24 IDQL---QLR---DSLRMYNSLVERCFVDCVDSFTRKSLQKQEETCVMRCAEKFLKHTMRVGMRF 82

  Fly    75 QEFQVIAHENA 85
            .|.    ::||
plant    83 AEL----NQNA 89

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 24/57 (42%)
TIM9NP_190240.1 zf-Tim10_DDP 26..82 CDD:281019 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2492
OMA 1 1.010
OrthoDB 1 1.010 D1627953at2759
OrthoInspector 1 1.000 T192728
orthoMCL 1 0.900 OOG5_129185
Panther 1 1.100 LDO PTHR13172
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.