powered by:
Protein Alignment Tim9a and TIM9
DIOPT Version :9
| Sequence 1: | NP_001285208.1 |
Gene: | Tim9a / 32294 |
FlyBaseID: | FBgn0030480 |
Length: | 95 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_190240.1 |
Gene: | TIM9 / 823809 |
AraportID: | AT3G46560 |
Length: | 93 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 76 |
Identity: | 32/76 - (42%) |
| Similarity: | 42/76 - (55%) |
Gaps: | 10/76 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 IDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRF 74
|||| |:: |.|..||.|.|.||.||:..||.:.::..||.|.:.|.||:||...||..||
plant 24 IDQL---QLR---DSLRMYNSLVERCFVDCVDSFTRKSLQKQEETCVMRCAEKFLKHTMRVGMRF 82
Fly 75 QEFQVIAHENA 85
.|. ::||
plant 83 AEL----NQNA 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Return to query results.
Submit another query.