DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim9a and timm10b

Sequence 1:NP_001285208.1 Gene:Tim9a FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001017829.1 Gene:timm10b ZFINID:ZDB-GENE-050417-370 Length:202 Species:Danio rerio

Alignment Length:90 Identity:29/91 (32%)
Similarity:45/91 (49%) Gaps:12/91 (13%)


  Fly    17 QIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQR------------ 69
            |::...|||:.||:::|.||..|..:|..|::...||:|..:|..|.::.|.|            
Zfish     6 QLRNLRDFLLVYNRMTEICFHRCSSNFNYRNLTMDEERCVDSCAGKLIRTNHRLMGTYVQLMPAM 70

  Fly    70 VSQRFQEFQVIAHENALAMAQKTGK 94
            |.:|.||.:..|.|.|.|.|:...|
Zfish    71 VQKRMQEMESKAAEMAKAEAEAAAK 95

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 21/69 (30%)
timm10bNP_001017829.1 zf-Tim10_DDP 6..63 CDD:281019 19/57 (33%)
Twin CX3C motif 24..48 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1627953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.