DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and Tim9b

DIOPT Version :9

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001027074.1 Gene:Tim9b / 3772213 FlyBaseID:FBgn0027358 Length:117 Species:Drosophila melanogaster


Alignment Length:82 Identity:22/82 - (26%)
Similarity:41/82 - (50%) Gaps:8/82 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAH 82
            ::...||...|||::|.||:.|:.:.:.||:...|:.|...|:.|:.:.||.:.:.:.:.|...:
  Fly     5 LRNLKDFFTLYNKVTELCFSRCVDNLSQRDLGGHEDLCVDRCVTKFARFNQNMMKVYVDVQTTIN 69

  Fly    83 --------ENALAMAQK 91
                    |||....|:
  Fly    70 AKRMEEMEENARKAEQQ 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 17/55 (31%)
Tim9bNP_001027074.1 zf-Tim10_DDP 4..61 CDD:281019 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13172
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.