DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim9a and timm9

Sequence 1:NP_001285208.1 Gene:Tim9a FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001153383.1 Gene:timm9 ZFINID:ZDB-GENE-021206-14 Length:89 Species:Danio rerio

Alignment Length:88 Identity:46/89 (52%)
Similarity:62/89 (70%) Gaps:3/89 (3%)


  Fly     8 IAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQ 72
            :|....:.||||.|.:||.:||||:|.||.||::|||||:||..|..||.:|::|||||.||:|.
Zfish     1 MAAQVTESDQIKQFKEFLGTYNKLTENCFMDCVKDFTTREVKPEETTCSESCLQKYLKMTQRISM 65

  Fly    73 RFQEFQVIAHENALAMAQKTGKL 95
            ||||:.:..:|   |:|.|.|.|
Zfish    66 RFQEYHIQQNE---ALAAKAGLL 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 35/57 (61%)
timm9NP_001153383.1 zf-Tim10_DDP 10..67 CDD:281019 35/57 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191316870
eggNOG 1 0.900 E1_KOG3479
Hieranoid 1 1.000
Homologene 1 1.000 H40847
Inparanoid 1 1.050 95 1.000 Inparanoid score I4976
OMA 1 1.010
OrthoDB 1 1.010 D1627953at2759
OrthoFinder 1 1.000 FOG0003354
OrthoInspector 1 1.000 T1054409
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13172
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1524
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.