DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9a and TIMM9

DIOPT Version :8

Sequence 1:NP_001285208.1 Gene:Tim9a / 32294 FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001291414.1 Gene:TIMM9 / 26520 HGNCID:11819 Length:89 Species:Homo sapiens

Alignment Length:94 Identity:49/95 (52%)
Similarity:65/95 (68%) Gaps:11/95 (12%)


  Fly     2 AKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKM 66
            |:.||:        ||||.|.:||.:||||:||||.||::|||||:||..|..||.:|::|||||
Human     3 AQIPES--------DQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKM 59

  Fly    67 NQRVSQRFQEFQVIAHENALAMAQKTGKL 95
            .||:|.||||:.:..:|   |:|.|.|.|
Human    60 TQRISMRFQEYHIQQNE---ALAAKAGLL 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 36/57 (63%)
TIMM9NP_001291414.1 zf-Tim10_DDP 10..67 CDD:335168 36/57 (63%)
Twin CX3C motif 28..52 14/24 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191321247
eggNOG 1 0.900 E1_KOG3479
Hieranoid 1 1.000
Homologene 1 1.000 H40847
Inparanoid 1 1.050 99 1.000 Inparanoid score I4928
Isobase 1 0.950 0.861654 Normalized mean entropy S713
OMA 1 1.010
OrthoDB 1 1.010 D1627953at2759
OrthoFinder 1 1.000 FOG0003354
OrthoInspector 1 1.000 T1075158
orthoMCL 1 0.900 OOG5_129185
Panther 1 1.100 LDO PTHR13172
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1524
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.