DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim9a and tim9

Sequence 1:NP_001285208.1 Gene:Tim9a FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_588008.1 Gene:tim9 PomBaseID:SPCC24B10.05 Length:84 Species:Schizosaccharomyces pombe

Alignment Length:74 Identity:28/75 (37%)
Similarity:45/75 (60%) Gaps:6/75 (8%)


  Fly    17 QIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIA 81
            :.|...::|..|:.|::.||:||::|||:..:.:.|.:|...|.:|:||.::||.|||.||    
pombe    17 EAKQLKEYLNMYSTLTQNCFSDCVQDFTSSKLSNKESECIAKCADKFLKHSERVGQRFAEF---- 77

  Fly    82 HENALAMAQ 90
              ||..|.|
pombe    78 --NAKYMGQ 84

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 21/57 (37%)
tim9NP_588008.1 zf-Tim10_DDP 14..74 CDD:281019 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1953
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003354
OrthoInspector 1 1.000 T1125802
orthoMCL 1 0.900 OOG5_129185
Panther 1 1.100 LDO PTHR13172
Phylome 1 0.910 0.880 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1524
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.