DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim9a and tin-9.1

Sequence 1:NP_001285208.1 Gene:Tim9a FlyBaseID:FBgn0030480 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001021307.1 Gene:tin-9.1 WormBaseID:WBGene00006572 Length:78 Species:Caenorhabditis elegans

Alignment Length:75 Identity:38/76 (50%)
Similarity:51/76 (67%) Gaps:1/76 (1%)


  Fly    15 KDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQV 79
            :..|:||.|||..||.::|.||..|:.:|.:|.|...||.|:.||::|:|||.|||||||||.|:
 Worm     4 EQNIQTFRDFLTQYNLVAEQCFNSCVNEFGSRTVSGKEESCANNCLDKFLKMTQRVSQRFQEHQL 68

  Fly    80 I-AHENALAM 88
            : |..|..||
 Worm    69 LNAQANGAAM 78

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim9aNP_001285208.1 zf-Tim10_DDP 17..74 CDD:281019 30/57 (53%)
tin-9.1NP_001021307.1 zf-Tim10_DDP 5..63 CDD:281019 30/58 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C189501419
eggNOG 1 0.900 E1_KOG3479
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I3727
Isobase 1 0.950 0.861654 Normalized mean entropy S713
OMA 1 1.010
OrthoDB 1 1.010 D1627953at2759
OrthoFinder 1 1.000 FOG0003354
OrthoInspector 1 1.000 T476578
orthoMCL 1 0.900 OOG5_129185
Panther 1 1.100 LDO PTHR13172
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1524
TreeFam 1 0.960
1413.750

Return to query results.
Submit another query.