powered by:
Protein Alignment dmrt11E and DMRTA2
DIOPT Version :9
| Sequence 1: | NP_511146.2 |
Gene: | dmrt11E / 32291 |
FlyBaseID: | FBgn0030477 |
Length: | 377 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_115486.1 |
Gene: | DMRTA2 / 63950 |
HGNCID: | 13908 |
Length: | 542 |
Species: | Homo sapiens |
| Alignment Length: | 85 |
Identity: | 50/85 - (58%) |
| Similarity: | 58/85 - (68%) |
Gaps: | 13/85 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 118 RTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEA---- 178
|||||||||||||:|.:|||||.|||::|.|..|.|:.:|||||||||||||||..|..||
Human 66 RTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENEARELQ 130
Fly 179 ----TASSTKSTGVTTASAN 194
||. |:..|:||
Human 131 LLYGTAE-----GLALAAAN 145
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3815 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.