DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and DMRTA2

DIOPT Version :8

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_115486.1 Gene:DMRTA2 / 63950 HGNCID:13908 Length:542 Species:Homo sapiens

Alignment Length:85 Identity:50/86 (58%)
Similarity:58/86 (67%) Gaps:13/86 (15%)


  Fly   118 RTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEA---- 178
            |||||||||||||:|.:|||||.|||::|.|..|.|:.:|||||||||||||||..|..||    
Human    66 RTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENEARELQ 130

  Fly   179 ----TASSTKSTGVTTASAN 194
                ||.     |:..|:||
Human   131 LLYGTAE-----GLALAAAN 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 33/46 (72%)
DMRTA2NP_115486.1 DM 66..112 CDD:279137 33/46 (72%)
CUE_DMA_DMRTA2 312..353 CDD:270601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.