DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and DMRTA2

DIOPT Version :10

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_115486.1 Gene:DMRTA2 / 63950 HGNCID:13908 Length:542 Species:Homo sapiens


Alignment Length:85 Identity:50/85 - (58%)
Similarity:58/85 - (68%) Gaps:13/85 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEA---- 178
            |||||||||||||:|.:|||||.|||::|.|..|.|:.:|||||||||||||||..|..||    
Human    66 RTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENEARELQ 130

  Fly   179 ----TASSTKSTGVTTASAN 194
                ||.     |:..|:||
Human   131 LLYGTAE-----GLALAAAN 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:459924 32/45 (71%)
DMRTA2NP_115486.1 DM 66..112 CDD:459924 32/45 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..316
CUE_DMA_DMRTA2 312..353 CDD:270601
DMRT5_DMB 434..513 CDD:466773
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.