DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and dsx

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster


Alignment Length:274 Identity:74/274 - (27%)
Similarity:102/274 - (37%) Gaps:93/274 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 PKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTME---ALEATAS 181
            |.||||||||:...:|||||.|::|.|.|..|:|..|||||||.|.||||.|..:   ||.....
  Fly    42 PNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQAQDEQRALHMHEV 106

  Fly   182 STKSTGVTTASANNSSSSEGEDSLSSTSPPPAHSHPH----------SHSHPTSCVSNSSSSSAT 236
            ...:...||..:::...:           .|||.|.|          .|||....:.:..:::|.
  Fly   107 PPANPAATTLLSHHHHVA-----------APAHVHAHHVHAHHAHGGHHSHHGHVLHHQQAAAAA 160

  Fly   237 RQALMAQKRIYKQRLRSLQQSTLHI----TAAMEEYKQRFPTFSSPLMERMRKRRAFADPELNHV 297
            ..|..|              ...|:    |||                                 
  Fly   161 AAAPSA--------------PASHLGGSSTAA--------------------------------- 178

  Fly   298 MEATLGGNA-LYFATVAAAAAACAPVHQEQ------HIYHPMPPTIPLTIPPTNPAMTTP----- 350
              :::.|:| .:...:||||||....||.|      |.:|......|...|.|..|:.:|     
  Fly   179 --SSIHGHAHAHHVHMAAAAAASVAQHQHQSHPHSHHHHHQNHHQHPHQQPATQTALRSPPHSDH 241

  Fly   351 ----AVTTASTGSG 360
                ...|:|:|.|
  Fly   242 GGSVGPATSSSGGG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 27/43 (63%)
dsxNP_001262353.1 DM 41..86 CDD:279137 27/43 (63%)
DSX_dimer 353..404 CDD:285978
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.