DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1764 and ddah2

Sequence 1:NP_001285198.1 Gene:CG1764 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001093535.1 Gene:ddah2 ZFINID:ZDB-GENE-030131-913 Length:286 Species:Danio rerio

Alignment Length:277 Identity:98/278 (35%)
Similarity:153/278 (55%) Gaps:24/278 (9%)


  Fly     5 YTHAIVARISDA---LLENG---KFDVQLAKQQHEQYCTLLR-TIGLDVIELPPDDQLPEGVFVE 62
            :|||||..|.::   |.|.|   :.|:..||:|.......|| .:||.:||:..|..|||...:|
Zfish    10 FTHAIVRGIPESFGKLAEGGDGFQTDIAKAKRQMGVLTGALRQKVGLQLIEIQVDSDLPESWRIE 74

  Fly    63 NSAVICNGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDP-----NAQLDGGDVLFTGRE 122
            :.|||....|||.|....:|..|||::..:| .||::.|:|:.:.     .|.|:|.||||||:|
Zfish    75 DIAVIQGDTALITRPFKQQRCCEAEAVRRVL-NELNMTVVEMGEEEGGSGGATLEGSDVLFTGKE 138

  Fly   123 FFVGISSFTNEEGARAVAMAYPEYPVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRME 187
            ||||||..||..||..:|..:.::.|:.:.|.|..|||...:|.||:.:.:|:|...::.::.||
Zfish   139 FFVGISKHTNHRGAEILADTFRDFAVSTVPVCGGSRLKNICSMGGPDTIIISNSDGAKKTLRVME 203

  Fly   188 REAICTYQKLTLPEESAANMLYINGT-----IVHRSPTEIPE---AYKTLKEKIDIPTRNINISE 244
            :.:...|:.|::.||.|||.:||.|.     ::|.:..|..:   |::.|.:...:||.   .||
Zfish   204 QLSDHHYEILSVSEEVAANCIYIRGPAKVDYLLHPTAEECSDSIAAFQRLTDYTLLPTA---CSE 265

  Fly   245 FSQYSSGLTSSCLLLRR 261
            .|:....|:|.|||:.:
Zfish   266 ASKLGGALSSFCLLINK 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 53/131 (40%)
ddah2NP_001093535.1 Amidinotransf 35..225 CDD:302778 72/191 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C95985
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I4485
OMA 1 1.010
OrthoDB 1 1.010 D1469762at2759
OrthoFinder 1 1.000 FOG0002793
OrthoInspector 1 1.000 T597910
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12737
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.