| Sequence 1: | NP_001285198.1 | Gene: | CG1764 / 32281 | FlyBaseID: | FBgn0030467 | Length: | 268 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_080237.1 | Gene: | Gatm / 67092 | MGIID: | 1914342 | Length: | 423 | Species: | Mus musculus |
| Alignment Length: | 321 | Identity: | 65/321 - (20%) |
|---|---|---|---|
| Similarity: | 117/321 - (36%) | Gaps: | 92/321 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 19 ENG-----KFDVQLAKQQHEQYCTLLRTIGLDVIELPPDD-----QLPE----GVFVENSAVICN 69
Fly 70 GVALIGRS--EHP----KRQLEAESMAIILKK---------------------ELDIPVIEIEDP 107
Fly 108 N---AQ-----------LDGGDVLFTGREFFVGISSFTNEEG----ARAVAMAYPEYPV------ 148
Fly 149 --TPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEI-VKRMEREAICTYQKLTLPEES------- 203
Fly 204 --AANMLYINGTIVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSSGLTS-SCLLLRR 261 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1764 | NP_001285198.1 | Amidinotransf | 24..>149 | CDD:302778 | 38/186 (20%) |
| Gatm | NP_080237.1 | Amidinotransf | 86..409 | CDD:302778 | 62/313 (20%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG1834 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||