DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1764 and Gatm

Sequence 1:NP_001285198.1 Gene:CG1764 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_080237.1 Gene:Gatm MGIID:1914342 Length:423 Species:Mus musculus

Alignment Length:321 Identity:65/322 (20%)
Similarity:117/322 (36%) Gaps:92/322 (29%)


  Fly    19 ENG-----KFDVQLAKQQHEQYCTLLRTIGLDVIELPPDD-----QLPE----GVFVENSAVICN 69
            :||     |..::.|..:.|:.|.:|...|:.|....|.|     :.|:    |::   ||:..:
Mouse   109 KNGGLYFPKDHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLY---SAMPRD 170

  Fly    70 GVALIGRS--EHP----KRQLEAESMAIILKK---------------------ELDIPVIEIEDP 107
            .:.::|..  |.|    .|..|..:...|:|.                     :.:.|:..:||.
Mouse   171 ILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDR 235

  Fly   108 N---AQ-----------LDGGDVLFTGREFFVGISSFTNEEG----ARAVAMAYPEYPV------ 148
            :   ||           .|..|.:..||:.|...|..||..|    .|.:|   |:|.|      
Mouse   236 HKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLA---PDYRVHIISFK 297

  Fly   149 --TPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEI-VKRMEREAICTYQKLTLPEES------- 203
              .|:.::.|      ..:.||.::..:....|.:| :.:.....|.|.....:|::.       
Mouse   298 DPNPMHIDAT------FNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSK 356

  Fly   204 --AANMLYINGTIVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSSGLTS-SCLLLRR 261
              :.|:|.::...|.....|:|  .:.:.||:.|.|..:||...:....|... :|.:.||
Mouse   357 WLSMNVLMLDEKRVMVDANEVP--IQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRR 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 38/187 (20%)
GatmNP_080237.1 Amidinotransf 86..409 CDD:302778 62/314 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1834
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.