DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1764 and Ddah2

Sequence 1:NP_001285198.1 Gene:CG1764 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001177378.1 Gene:Ddah2 MGIID:1859016 Length:285 Species:Mus musculus

Alignment Length:269 Identity:90/270 (33%)
Similarity:150/270 (56%) Gaps:16/270 (6%)


  Fly     6 THAIVARISDALLEN-----GKFDVQLAKQQHEQYC---TLLRTIGLDVIELPPDDQLPEGVFVE 62
            :||::..:.::|...     |...:.|||.|.|...   .|.:.:||.::||||::.||.|..:.
Mouse    12 SHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLG 76

  Fly    63 NSAVICNGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGI 127
            ::|||....|||.|...|.|:.|.:.:...| ::|.:.::|:.|.||.|||.||||||||||||:
Mouse    77 DTAVIQGDTALITRPWSPARRPEVDGVRKAL-QDLGLRIVEMGDENATLDGTDVLFTGREFFVGL 140

  Fly   128 SSFTNEEGARAVAMAYPEYPVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAIC 192
            |.:||..||..||..:.::.|:.:.|:|:..|:....|.||..:...||...|:.|:.|......
Mouse   141 SKWTNHRGAEIVADTFRDFAVSTVPVSGSSHLRGLCGMGGPRTVVAGSSEAAQKAVRAMAALTDH 205

  Fly   193 TYQKLTLPEESAANMLYIN----GT---IVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSS 250
            .|..||||:::|::.|::.    |.   ::||...::|.:.:.|::..|:....::.||..:..:
Mouse   206 PYASLTLPDDAASDCLFLRPGLPGATPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKAGA 270

  Fly   251 GLTSSCLLL 259
            ||:|.||:|
Mouse   271 GLSSLCLVL 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 54/128 (42%)
Ddah2NP_001177378.1 Amidinotransf <62..277 CDD:354389 76/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99734
eggNOG 1 0.900 E1_COG1834
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3982
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1469762at2759
OrthoFinder 1 1.000 FOG0002793
OrthoInspector 1 1.000 T617014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12737
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5737
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.