DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1764 and ddah2

Sequence 1:NP_001285198.1 Gene:CG1764 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001004924.1 Gene:ddah2 XenbaseID:XB-GENE-486753 Length:272 Species:Xenopus tropicalis

Alignment Length:269 Identity:100/270 (37%)
Similarity:157/270 (58%) Gaps:9/270 (3%)


  Fly     1 MSPKYTHAIVARISDALLE--NGKFDVQLAKQQHEQYCTLLR-TIGLDVIELPPDDQLPEGVFVE 62
            ||.:||||:|..:..:|.:  ||:.|:..|::::..||.:|| .:||.|:||||:::||:|..:.
 Frog     1 MSGRYTHAVVRGVPSSLAKEANGQVDLARAQRENGVYCGILRQKLGLQVVELPPNEELPQGQLIG 65

  Fly    63 NSAVICNGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGI 127
            ::||:....|||.|...|.|:.|.|.:..|. :||...|.|:.|.||.||..|:||||.|.|||:
 Frog    66 DTAVVIADTALITRPWIPARRKETEGLQKIF-EELKFRVCELNDENATLDASDILFTGSEIFVGL 129

  Fly   128 SSFTNEEGARAVAMAYPEYPVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAIC 192
            |.:||..||..||..|.:|.|:.:.|:|...||.:.:|.||:.|.:.||.|.::.:|.||:....
 Frog   130 SKWTNLRGAEMVAKTYQDYAVSTVPVSGDLHLKSFCSMGGPDTLVIGSSDTAKKALKTMEQLTDH 194

  Fly   193 TYQKLTLPEESAANMLYI-----NGTIVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSSGL 252
            .|:.||:|::.|||.:|.     :..::|||..|.|.:.:..::..|........:|.|:....|
 Frog   195 HYETLTVPDDPAANCIYARVGPKSNVLIHRSVDEYPNSAQVFQKLTDYTLVPATCTELSKIGGFL 259

  Fly   253 TSSCLLLRR 261
            ||..:|:.|
 Frog   260 TSCSILINR 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 55/126 (44%)
ddah2NP_001004924.1 Amidinotransf 3..263 CDD:327513 96/261 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99354
eggNOG 1 0.900 E1_COG1834
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I3646
OMA 1 1.010
OrthoDB 1 1.010 D1469762at2759
OrthoFinder 1 1.000 FOG0002793
OrthoInspector 1 1.000 T602057
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5737
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.