DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1764 and ddah1

Sequence 1:NP_001285198.1 Gene:CG1764 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_998441.1 Gene:ddah1 ZFINID:ZDB-GENE-010724-13 Length:264 Species:Danio rerio

Alignment Length:265 Identity:98/266 (37%)
Similarity:156/266 (59%) Gaps:16/266 (6%)


  Fly     8 AIVARISDALLEN---GKFDVQLAKQQHEQYCTLLR-TIGLDVIELPPDDQLPEGVFVENSAVIC 68
            |:.|.:|.|.|.:   ...|....:::.:.|.::|| .:||.|:.||.|::||:.||||::||:|
Zfish     3 AMPASLSTAALRSDNVSPVDPLGVQREFDHYVSVLRDRLGLQVVMLPADEELPDCVFVEDTAVVC 67

  Fly    69 NGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGISSFTNE 133
            ...|||.|...|.|:.|..:|...| .||.:.::|:.|.:|.:|||||||||:|||||:|..||:
Zfish    68 GSTALITRPGAPSRRSETVAMKGAL-TELGLNIVEMNDESATMDGGDVLFTGKEFFVGLSKRTNQ 131

  Fly   134 EGARAVAMAYPEYPVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAICTYQKLT 198
            .||..:|..:.:|.|:.|.|.....||.:.:||||.::.:.||...|:.:|.:::.:.|.|:|||
Zfish   132 RGAEILANTFKDYAVSTIPVEEGLHLKSFCSMAGPNLIAIGSSDAAQKALKVIQQMSDCKYEKLT 196

  Fly   199 LPEESAANMLYIN-----GTIVHRSPTEIPEA---YKTLKEKIDIPTRNINISEFSQYSSGLTSS 255
            :|::.|||.:|:|     ..::|.:|...||:   ::.||..:.||..|   .|..:....||..
Zfish   197 VPDDRAANCVYMNLPGKGDVLLHCTPEVFPESAKVFERLKSHMLIPVSN---QEKMKVDGALTCL 258

  Fly   256 CLLLR 260
            .:|||
Zfish   259 SVLLR 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 55/126 (44%)
ddah1NP_998441.1 Amidinotransf 20..264 CDD:302778 93/249 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110644
eggNOG 1 0.900 E1_COG1834
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H8120
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1469762at2759
OrthoFinder 1 1.000 FOG0002793
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132130
Panther 1 1.100 LDO PTHR12737
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.