DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1764 and gatm

Sequence 1:NP_001285198.1 Gene:CG1764 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_988971.1 Gene:gatm XenbaseID:XB-GENE-974514 Length:422 Species:Xenopus tropicalis

Alignment Length:321 Identity:61/322 (19%)
Similarity:113/322 (35%) Gaps:109/322 (34%)


  Fly    25 VQLAKQQHEQYCTLLRTIGLDVIELP-----------PDDQ-------LPEGVFVENSAVICNGV 71
            |:.|.::.|:.|.:||..|: |::.|           ||.:       :|..:.:    |:.|.:
 Frog   119 VKKATEEIEEMCNVLRHEGV-VVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILL----VVGNEI 178

  Fly    72 ALIGRSEHP----KRQLEAESMAIILKK---------------------ELDIPVIEIEDPNAQ- 110
            .     |.|    .|..|..:...::|.                     :.|.|:..:||.:.. 
 Frog   179 I-----EAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLA 238

  Fly   111 -------------LDGGDVLFTGREFFVGISSFTNEEG----ARAVAMAYPEYPV--------TP 150
                         .|..|.:..||:.|...|..||..|    .|.:|   |:|.|        .|
 Frog   239 AMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLA---PDYKVHIISFKDPNP 300

  Fly   151 IRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREA---ICTYQKLTLPEES--------- 203
            :.::.|      ..:.||.::..:....|.:|  .:.::|   :.|.....:|:..         
 Frog   301 MHIDAT------FNIIGPGLVLSNPDRPCHQI--ELFKKAGWTVVTPPIPLIPDNHPLWMSSKWL 357

  Fly   204 AANMLYIN--GTIVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSSGLTS-SCLLLRR 261
            :.|:|.::  ..:|..:.|.|.:.:    ||:.|.|..:||...:....|... :|.:.||
 Frog   358 SMNVLMLDEKRVMVDANETSIQKMF----EKLGISTIKVNIRHANSLGGGFHCWTCDIRRR 414

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 37/193 (19%)
gatmNP_988971.1 Amidinotransf 73..408 CDD:327513 58/314 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1834
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.