DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1764 and DDAH1

Sequence 1:NP_001285198.1 Gene:CG1764 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_036269.1 Gene:DDAH1 HGNCID:2715 Length:285 Species:Homo sapiens

Alignment Length:270 Identity:108/271 (40%)
Similarity:168/271 (62%) Gaps:21/271 (8%)


  Fly     6 THAIVARISDAL----LENGK---FDVQLAKQQHEQYCTLLRT-IGLDVIELPPDDQLPEGVFVE 62
            |||:|..:.::|    |.:.|   .||..|::||:.|..:|.: :||.|:|||.|:.||:.||||
Human    14 THAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVE 78

  Fly    63 NSAVICNGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGI 127
            :.||:|...|||.|...|.|:.|.:.|...|:| |.:.::|::|.||.||||||||||||||||:
Human    79 DVAVVCEETALITRPGAPSRRKEVDMMKEALEK-LQLNIVEMKDENATLDGGDVLFTGREFFVGL 142

  Fly   128 SSFTNEEGARAVAMAYPEYPVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAIC 192
            |..||:.||..:|..:.:|.|:.:.|.....||.:.:||||.::.:.||.:.|:.:|.|::.:..
Human   143 SKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDH 207

  Fly   193 TYQKLTLPEESAANMLYIN-----GTIVHRSPTEIPEA---YKTLKEKIDIPTRNINISEFSQYS 249
            .|.|||:|::.|||.:|:|     ..::||:|.|.||:   |:.||:.:.||   :::||..:. 
Human   208 RYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIP---VSMSELEKV- 268

  Fly   250 SGLTSSCLLL 259
            .||.:.|.:|
Human   269 DGLLTCCSVL 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 62/126 (49%)
DDAH1NP_036269.1 Amidinotransf 11..276 CDD:327513 107/267 (40%)
Substrate binding 78..79 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115563
eggNOG 1 0.900 E1_COG1834
Hieranoid 1 1.000
Homologene 1 1.000 H8120
Inparanoid 1 1.050 182 1.000 Inparanoid score I3916
Isobase 1 0.950 0 Normalized mean entropy S6655
OMA 1 1.010
OrthoDB 1 1.010 D1469762at2759
OrthoFinder 1 1.000 FOG0002793
OrthoInspector 1 1.000 T610208
orthoMCL 1 0.900 OOG5_132130
Panther 1 1.100 LDO PTHR12737
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5737
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.