DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1764 and DDAH2

Sequence 1:NP_001285198.1 Gene:CG1764 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001289936.1 Gene:DDAH2 HGNCID:2716 Length:285 Species:Homo sapiens

Alignment Length:272 Identity:94/273 (34%)
Similarity:152/273 (56%) Gaps:22/273 (8%)


  Fly     6 THAIVARISDALLEN-----GKFDVQLAKQQHEQYC---TLLRTIGLDVIELPPDDQLPEGVFVE 62
            :||::..:.::|...     |...:.|||.|.|...   .|.:.:||.::||||::.||.|..:.
Human    12 SHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLG 76

  Fly    63 NSAVICNGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGI 127
            ::|||....|||.|...|.|:.|.:.:...| ::|.:.::||.|.||.|||.||||||||||||:
Human    77 DTAVIQGDTALITRPWSPARRPEVDGVRKAL-QDLGLRIVEIGDENATLDGTDVLFTGREFFVGL 140

  Fly   128 SSFTNEEGARAVAMAYPEYPVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAIC 192
            |.:||..||..||..:.::.|:.:.|:|...|:....|.||..:...||...|:.|:.|   |:.
Human   141 SKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVAGSSDAAQKAVRAM---AVL 202

  Fly   193 T---YQKLTLPEESAANMLYIN----GT---IVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQ 247
            |   |..||||:::||:.|::.    |.   ::||...::|.:.:.|::..|:....::.||..:
Human   203 TDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEK 267

  Fly   248 YSSGLTSSCLLL 259
            ..:||:|.||:|
Human   268 AGAGLSSLCLVL 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 55/128 (43%)
DDAH2NP_001289936.1 Amidinotransf <62..277 CDD:327513 80/219 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C100213
eggNOG 1 0.900 E1_COG1834
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I3916
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1469762at2759
OrthoFinder 1 1.000 FOG0002793
OrthoInspector 1 1.000 T610208
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12737
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5737
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.