DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1764 and ZK1307.1

DIOPT Version :9

Sequence 1:NP_001285198.1 Gene:CG1764 / 32281 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001022509.1 Gene:ZK1307.1 / 174519 WormBaseID:WBGene00014244 Length:279 Species:Caenorhabditis elegans


Alignment Length:275 Identity:67/275 - (24%)
Similarity:109/275 - (39%) Gaps:72/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GKFDVQLAKQQHEQYCTLLRTIGLDVIELPPDDQLPEGVFVENSAVICNGVALIGRSEHPKRQLE 85
            |..|.|.|.||.....:.:...|:.|:.:...:.||:.|||.||.::.:....:.|..|.:|..|
 Worm    40 GVVDKQKAHQQWNSLKSAIENAGVPVLTMEQTEGLPDQVFVCNSGLVYDDQVYLSRFRHKERSGE 104

  Fly    86 AESMAIILKKELDIPVI-----EIEDPNAQLDGGDVLFTGRE-FFVGI---SSFTNEEGARAVA- 140
             :.:.:...|:.:|..|     ||.:     .|||.:|:.|: .:.|.   ||.:..|..:|:. 
 Worm   105 -QPLYLEWFKKNNIKTIGEGYEEIFE-----GGGDAVFSDRKTLWAGYGERSSKSVYEKIKALGT 163

  Fly   141 -------MAYPEY--------PVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRM---- 186
                   |..|.:        |     |:.|..|.|      |...   |..|.:||::|:    
 Worm   164 FDIVLCDMILPNFYHLDTCFAP-----VDETSALYY------PPAF---SEATNKEILRRLPNSI 214

  Fly   187 ---EREA---ICTYQKLTLPEESAANMLYINGTIVHRSPTEIPEAYKTLKEKIDIPTRNINISEF 245
               |.||   :|             |.:.|..|::  ||..:.:|.|............:::|||
 Worm   215 AVSEAEANAFVC-------------NAITIRDTVI--SPIGVSQATKDYLSARGKRVEEVDMSEF 264

  Fly   246 SQYSSGLTSSCLLLR 260
            .:  ||....||:||
 Worm   265 MK--SGGACQCLVLR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 36/149 (24%)
ZK1307.1NP_001022509.1 Amidinotransf 17..278 CDD:302778 67/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.