DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1764 and ddah1

Sequence 1:NP_001285198.1 Gene:CG1764 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001120524.1 Gene:ddah1 XenbaseID:XB-GENE-980345 Length:284 Species:Xenopus tropicalis

Alignment Length:276 Identity:114/277 (41%)
Similarity:170/277 (61%) Gaps:20/277 (7%)


  Fly     6 THAIVARISDAL------LENGK-FDVQLAKQQHEQYCTLLRT-IGLDVIELPPDDQLPEGVFVE 62
            |||||..|.|:|      .|.|. .|:.||::.||||..:|:. :||.|||||.|:.||:..|||
 Frog    13 THAIVRAIPDSLCQEALRTEKGSVVDISLARKHHEQYVGVLKNKLGLSVIELPADECLPDAPFVE 77

  Fly    63 NSAVICNGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGI 127
            :.|::|...|||.|...|.|:.|||::...| ::|.:.|:|:.|.||.||||||||||||||||:
 Frog    78 DVAIVCEETALITRPGAPSRRKEAEAVKKAL-QDLQLNVVEMTDENATLDGGDVLFTGREFFVGL 141

  Fly   128 SSFTNEEGARAVAMAYPEYPVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAIC 192
            |..||:.||..:|..:.:|.|:.:.|..|..||.:.:||||.::.:.||...|:.:|.|::.:..
 Frog   142 SKRTNQRGAEILADTFKDYAVSTVPVCETLHLKSFCSMAGPNLIAIGSSEAAQKALKTMQQMSDH 206

  Fly   193 TYQKLTLPEESAANMLYIN-----GTIVHRSPTEIPEA---YKTLKEKIDIPTRNINISEFSQYS 249
            .|.|||||:::|||.:|:|     ..::||:|.:.||:   ::.|||.:.||..|   :|.::..
 Frog   207 RYDKLTLPDDAAANCIYLNIPSKGHVLLHRAPEDFPESAKVFEKLKEHMLIPLPN---TELAKVD 268

  Fly   250 SGLTSSCLLLRRWKSI 265
            ..||...||:.:..|:
 Frog   269 GCLTCCSLLINKKTSL 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 63/126 (50%)
ddah1NP_001120524.1 Amidinotransf 14..278 CDD:327513 112/268 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114920
eggNOG 1 0.900 E1_COG1834
Hieranoid 1 1.000
Homologene 1 1.000 H8120
Inparanoid 1 1.050 192 1.000 Inparanoid score I3646
OMA 1 1.010
OrthoDB 1 1.010 D1469762at2759
OrthoFinder 1 1.000 FOG0002793
OrthoInspector 1 1.000 T602057
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5737
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.