DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coq5 and COQ5

Sequence 1:NP_001285193.1 Gene:Coq5 FlyBaseID:FBgn0030460 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_013597.1 Gene:COQ5 SGDID:S000004578 Length:307 Species:Saccharomyces cerevisiae

Alignment Length:299 Identity:131/300 (44%)
Similarity:184/300 (61%) Gaps:15/300 (5%)


  Fly    10 LSLARRFVHTRTASQSAQNSKGMASGAESISGKEKTTHFGFQTVRESEKEQKVHEVFEQVANSYD 74
            |.|:|.|.....|.:..:.:..::|.||  ..::|.||||.:||.:|.|::.|.:||..|||.||
Yeast    17 LRLSRCFTQAHRACKEEEVNSPLSSAAE--QPEQKYTHFGSKTVLKSTKQKLVGDVFSSVANRYD 79

  Fly    75 VMNDAMSLGIHRVWKDVFVERL------GPTHGMRLLDMAGGTGDITFRYLRYLNNQPNPQQRPS 133
            :|||.|||||||:|||.|:.:|      ..|..:..:|:|||:|||.|..|.:..::....:  |
Yeast    80 LMNDVMSLGIHRLWKDHFINKLDAGKRPNSTTPLNFIDVAGGSGDIAFGLLDHAESKFGDTE--S 142

  Fly   134 HVTVSDINQHMLNVGEERAKRLGLTTDQLSNCTVAWQCADAEKLPFPDA-SFTAYTIAFGIRNCT 197
            .:.:.|||..||..||:||...|   ....:..|.:..::.|||...|: |...||::|||||.|
Yeast   143 TMDIVDINPDMLKEGEKRAMEQG---KYFKDPRVRFLVSNGEKLEEIDSDSKDIYTVSFGIRNFT 204

  Fly   198 HVDKVLSEAYRVLQPGGRFMCLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESI 262
            .:.|.|:.|||||:|||.|.|||||.:.|..|.:.|.|:: :|:|.||.::|..:.:||||||||
Yeast   205 DIQKGLNTAYRVLKPGGIFYCLEFSKIENPLMDFAYQQWA-KVLPVMGSMIANDYDSYQYLVESI 268

  Fly   263 RRFPKQEQFKQMIEQAGFDQVSYENLTFGVVSIHSGFKL 301
            .|||.||.||.|||:|||....||:||||:.:||.|.|:
Yeast   269 ERFPDQETFKSMIEKAGFKSAGYESLTFGICAIHWGIKV 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Coq5NP_001285193.1 ubiE 50..301 CDD:234689 118/258 (46%)
COQ5NP_013597.1 Ubie_methyltran 67..306 CDD:279542 113/245 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C201352951
eggNOG 1 0.900 E1_COG2226
Hieranoid 1 1.000
Homologene 1 1.000 H6559
Inparanoid 1 1.050 228 1.000 Inparanoid score I730
Isobase 1 0.950 0 Normalized mean entropy S913
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004356
OrthoInspector 1 1.000 T1136806
orthoMCL 1 0.900 OOG5_127211
Panther 1 1.100 LDO PTHR43591
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R235
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.