DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coq5 and COQ5

Sequence 1:NP_001285193.1 Gene:Coq5 FlyBaseID:FBgn0030460 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_115690.3 Gene:COQ5 HGNCID:28722 Length:327 Species:Homo sapiens

Alignment Length:322 Identity:161/323 (50%)
Similarity:201/323 (62%) Gaps:59/323 (18%)


  Fly     6 STRLLSLARRFVHTRTASQSAQNSKGMASGAESISGKEKTTHFGFQTVRESEKEQKVHEVFEQVA 70
            |.||||..:|                   .||        |||||:||.|.||..||::|||.||
Human    39 SARLLSQEKR-------------------AAE--------THFGFETVSEEEKGGKVYQVFESVA 76

  Fly    71 NSYDVMNDAMSLGIHRVWKDVFVERLGPTHGMRLLDMAGGTGDITFRYLRYLNNQPNPQQR---- 131
            ..||||||.|||||||||||:.:.::.|..|.:|||:|||||||.||:|.|:.:|...:|:    
Human    77 KKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLR 141

  Fly   132 ----------------------PSHVTVSDINQHMLNVGEERAKRLGLTTDQLSNCTVAWQCADA 174
                                  .|.|.|.|||:.||.||:::|...|.      ...:||...||
Human   142 AQQNLSWEEIAKEYQNEEDSLGGSRVVVCDINKEMLKVGKQKALAQGY------RAGLAWVLGDA 200

  Fly   175 EKLPFPDASFTAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFMCLEFSHLTNETMQWLYDQYSFQ 239
            |:|||.|..|..|||||||||.||:|:.|.||:|||:|||||:|||||.:.|..:..|||.||||
Human   201 EELPFDDDKFDIYTIAFGIRNVTHIDQALQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQ 265

  Fly   240 VIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFKQMIEQAGFDQVSYENLTFGVVSIHSGFKL 301
            |||.:|:::||.|::||||||||||||.||:||.|||.|||.:|:||:||.|:|:|||||||
Human   266 VIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Coq5NP_001285193.1 ubiE 50..301 CDD:234689 148/277 (53%)
COQ5NP_115690.3 ubiE 56..327 CDD:234689 148/277 (53%)
S-adenosyl-L-methionine binding. {ECO:0000255|HAMAP-Rule:MF_03191} 199..200 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C201342633
eggNOG 1 0.900 E1_COG2226
Hieranoid 1 1.000
Homologene 1 1.000 H6559
Inparanoid 1 1.050 302 1.000 Inparanoid score I2643
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1125002at2759
OrthoFinder 1 1.000 FOG0004356
OrthoInspector 1 1.000 T1075161
orthoMCL 1 0.900 OOG5_127211
Panther 1 1.100 LDO PTHR43591
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.