DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coq5 and MENG

Sequence 1:NP_001285193.1 Gene:Coq5 FlyBaseID:FBgn0030460 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_173750.3 Gene:MENG AraportID:AT1G23360 Length:261 Species:Arabidopsis thaliana

Alignment Length:247 Identity:73/248 (29%)
Similarity:117/248 (47%) Gaps:26/248 (10%)


  Fly    51 QTVRESEKEQKVHEVFEQVANSYDVMNDAMSLGIHRVWKDVFVERLGPTHGMRLLDMAGGTGDIT 115
            :||.:...|:::  :|.::|..||.:||.:|||.||:||::.|...|...|..:||:..|:||:.
plant    26 RTVVKCSNERRI--LFNRIAPVYDNLNDLLSLGQHRIWKNMAVSWSGAKKGDYVLDLCCGSGDLA 88

  Fly   116 FRYLRYLNNQPNPQQRPSHVTVSDINQHMLNVGEERAKRLGLTTDQLSNCTVAWQCADAEKLPFP 180
            |.....:.:       ...|...|.:...|.|.   |.|..|.......| :.|...||..|||.
plant    89 FLLSEKVGS-------TGKVMGLDFSSEQLAVA---ATRQSLKARSCYKC-IEWIEGDAIDLPFD 142

  Fly   181 DASFTAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFMCLEFS----HLTNETMQWLYDQYSFQVI 241
            |..|.|.|:.:|:||.....:.:.|.||||:||.|...|:|:    .:|.....|:.|    .|:
plant   143 DCEFDAVTMGYGLRNVVDRLRAMKEMYRVLKPGSRVSILDFNKSNQSVTTFMQGWMID----NVV 203

  Fly   242 PPMGQL--LAGQWQAYQYLVESIRRFPKQEQFKQMIEQAGFDQVSYENLTFG 291
            .|:..:  ||   :.|:||..||..:...|:.:.:..:|||....:..::.|
plant   204 VPVATVYDLA---KEYEYLKYSINGYLTGEELETLALEAGFSSACHYEISGG 252

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Coq5NP_001285193.1 ubiE 50..301 CDD:234689 73/248 (29%)
MENGNP_173750.3 PLN02233 1..261 CDD:177877 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1125002at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.