DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coq5 and coq5

Sequence 1:NP_001285193.1 Gene:Coq5 FlyBaseID:FBgn0030460 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_587834.1 Gene:coq5 PomBaseID:SPCC4G3.04c Length:305 Species:Schizosaccharomyces pombe

Alignment Length:308 Identity:149/309 (48%)
Similarity:188/309 (61%) Gaps:33/309 (11%)


  Fly     5 RSTRL----LSLARRFVHTRTASQSAQNSKGMASGAESISGKEKTTHFGFQTVRESEKEQKVHEV 65
            |||.|    ||..|   :|.|:|:....|..|             |||||:.|.|.|||..|..|
pombe    20 RSTALAGSRLSNCR---YTSTSSKDTDTSSHM-------------THFGFKDVPEDEKEHLVKNV 68

  Fly    66 FEQVANSYDVMNDAMSLGIHRVWKDVFVERLGP---THGMRLLDMAGGTGDITFRYLRYLNNQPN 127
            |..||..||.|||||||||||:||::||.||.|   |..|::||:|||||||.||.|.:..|...
pombe    69 FSSVAKKYDEMNDAMSLGIHRLWKNIFVSRLNPGNSTVPMKILDVAGGTGDIAFRILNHATNHNG 133

  Fly   128 PQQRPSHVTVSDINQHMLNVGEERAKRLGLTTDQLSNCTVAWQCADAEKL-PFPDASFTAYTIAF 191
              .|.:.|.|:|||..||:||..|:|:    |....:..|.:...:||.| ..||.|...|||||
pombe   134 --DRNTRVIVADINPDMLSVGLRRSKK----TPYYDSGRVEFIEQNAEILDKIPDNSIDMYTIAF 192

  Fly   192 GIRNCTHVDKVLSEAYRVLQPGGRFMCLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQ 256
            |||||||:.|||.:|||||:|||.|.|||||.:....:..||.||||:::|.:|.::||..|:|:
pombe   193 GIRNCTHIPKVLEQAYRVLKPGGVFSCLEFSKVYPAPLAELYRQYSFKILPLLGTIIAGDSQSYE 257

  Fly   257 YLVESIRRFPKQEQFKQMIEQAGF---DQVSYENLTFGVVSIHSGFKL 301
            ||||||.|||..:.|.:|||.|||   .:..||.|:||:.:||:|.||
pombe   258 YLVESIERFPDAKTFAKMIEDAGFTLAGETGYETLSFGIAAIHTGIKL 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Coq5NP_001285193.1 ubiE 50..301 CDD:234689 132/258 (51%)
coq5NP_587834.1 ubiE 53..305 CDD:234689 132/258 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6559
Inparanoid 1 1.050 253 1.000 Inparanoid score I761
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004356
OrthoInspector 1 1.000 T1125805
orthoMCL 1 0.900 OOG5_127211
Panther 1 1.100 LDO PTHR43591
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R235
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.