DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coq5 and coq-5

Sequence 1:NP_001285193.1 Gene:Coq5 FlyBaseID:FBgn0030460 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_498704.1 Gene:coq-5 WormBaseID:WBGene00000765 Length:285 Species:Caenorhabditis elegans

Alignment Length:287 Identity:140/288 (49%)
Similarity:189/288 (66%) Gaps:25/288 (9%)


  Fly    14 RRFVHTRTASQSAQNSKGMASGAESISGKEKTTHFGFQTVRESEKEQKVHEVFEQVANSYDVMND 78
            |:|...:..|.:.::..|            |.|||||..|.|:|||||||.||..||..||:|||
 Worm    21 RQFSVNQVNSDNKRSEPG------------KKTHFGFTDVDEAEKEQKVHHVFANVAKKYDLMND 73

  Fly    79 AMSLGIHRVWKDVFVERLGPTHGMRLLDMAGGTGDITFRYLRYLNNQPNPQQRPSHVTVSDINQH 143
            |||:|:||:|||.:|..|...:..:.||||||||||.||.||:     :|..:   ||||||||.
 Worm    74 AMSMGVHRLWKDYYVGGLQVPYNAKCLDMAGGTGDIAFRILRH-----SPTAK---VTVSDINQP 130

  Fly   144 MLNVGEERAKRLGLTTDQLSNCTVAWQCADAEKLPFPDASFTAYTIAFGIRNCTHVDKVLSEAYR 208
            ||:||::||::    ...:......|.||:||::||...::..:|::||||||||.:||:.||:|
 Worm   131 MLDVGKKRAEK----ERDIQPSRAEWVCANAEQMPFESNTYDLFTMSFGIRNCTHPEKVVREAFR 191

  Fly   209 VLQPGGRFMCLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFKQ 273
            ||:|||:...||||.: |..::.:||.|||.|||.:|::||....:|||||||||:||.|::|.:
 Worm   192 VLKPGGQLAILEFSEV-NSALKPIYDAYSFNVIPVLGEILASDRASYQYLVESIRKFPNQDEFAR 255

  Fly   274 MIEQAGFDQVSYENLTFGVVSIHSGFK 300
            :|.:.||..|.||||||||.|||.|.|
 Worm   256 IIREEGFSNVRYENLTFGVCSIHKGMK 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Coq5NP_001285193.1 ubiE 50..301 CDD:234689 131/252 (52%)
coq-5NP_498704.1 MenG_MenH_UbiE 57..282 CDD:273884 122/238 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C201335005
eggNOG 1 0.900 E1_COG2226
Hieranoid 1 1.000
Homologene 1 1.000 H6559
Inparanoid 1 1.050 269 1.000 Inparanoid score I1829
Isobase 1 0.950 0 Normalized mean entropy S913
OMA 1 1.010
OrthoDB 1 1.010 D1125002at2759
OrthoFinder 1 1.000 FOG0004356
OrthoInspector 1 1.000 T476041
orthoMCL 1 0.900 OOG5_127211
Panther 1 1.100 LDO PTHR43591
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R235
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.