DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coq5 and coq5

Sequence 1:NP_001285193.1 Gene:Coq5 FlyBaseID:FBgn0030460 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_002932125.1 Gene:coq5 XenbaseID:XB-GENE-981147 Length:311 Species:Xenopus tropicalis

Alignment Length:285 Identity:151/286 (53%)
Similarity:194/286 (68%) Gaps:33/286 (12%)


  Fly    44 KTTHFGFQTVRESEKEQKVHEVFEQVANSYDVMNDAMSLGIHRVWKDVFVERLGPTHGMRLLDMA 108
            |.||||||||.|.||.:||:.|||.||::||:||||||||:||.|||..::.:.||.||:|||:|
 Frog    33 KETHFGFQTVSEEEKGEKVYRVFENVAHNYDIMNDAMSLGVHRFWKDWLLQLMKPTPGMQLLDVA 97

  Fly   109 GGTGDITFRYLRYLNNQ------------------------PNPQQRP---SHVTVSDINQHMLN 146
            ||||||.||::.|:..|                        .|.:|..   |...:.|||:.||.
 Frog    98 GGTGDIAFRFINYIRAQREKWIRQELKLQQDLSWPDISKTYQNKEQSSLMGSRAVICDINKEMLR 162

  Fly   147 VGEERAKRLGLTTDQLSNCTVAWQCADAEKLPFPDASFTAYTIAFGIRNCTHVDKVLSEAYRVLQ 211
            ||.:::.|||.:..      ::|...|||:|||.|..|..|||||||||.||:::.|.||||||:
 Frog   163 VGLQKSLRLGYSEG------LSWVAGDAEELPFDDDKFDVYTIAFGIRNVTHIEQALQEAYRVLK 221

  Fly   212 PGGRFMCLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFKQMIE 276
            |||||:|||||.:.|..:..|||.|||||||.:|:::||.|::||||||||||||.||:||.:||
 Frog   222 PGGRFLCLEFSQVNNPMLSKLYDIYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKALIE 286

  Fly   277 QAGFDQVSYENLTFGVVSIHSGFKL 301
            ..||.:|:|.|||.|||::||||||
 Frog   287 DVGFCKVNYHNLTNGVVAVHSGFKL 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Coq5NP_001285193.1 ubiE 50..301 CDD:234689 145/278 (52%)
coq5XP_002932125.1 ubiE 39..311 CDD:234689 145/278 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C201345521
eggNOG 1 0.900 E1_COG2226
Hieranoid 1 1.000
Homologene 1 1.000 H6559
Inparanoid 1 1.050 302 1.000 Inparanoid score I2501
OMA 1 1.010
OrthoDB 1 1.010 D1125002at2759
OrthoFinder 1 1.000 FOG0004356
OrthoInspector 1 1.000 T1061211
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R235
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.