DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4318 and Klf13

Sequence 1:NP_572860.2 Gene:CG4318 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_067341.2 Gene:Klf13 MGIID:1354948 Length:289 Species:Mus musculus

Alignment Length:116 Identity:33/117 (28%)
Similarity:52/117 (44%) Gaps:13/117 (11%)


  Fly   125 PNSNSNGNGNVSQSSAQKDTKKKMLKKTHKCNI--CGKYFMLPAHLKCHMWVHAREKPYKC--LQ 185
            |.....|....|::..:...:|      |||:.  |.|.:...:|||.|:..|..|:|:.|  .:
Mouse   146 PGLRQRGRRGRSRADLESPQRK------HKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACSWQE 204

  Fly   186 CSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKIFNRNSALKNHETMHHN 236
            |::.:|:...|.||.|.|:..   :.:.|..|.|.|.|:..|..|...|.|
Mouse   205 CNKKFARSDELARHYRTHTGE---KKFSCPICEKRFMRSDHLTKHARRHAN 252

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071
C2H2 Zn finger 155..175 CDD:275368 7/22 (32%)
zf-H2C2_2 167..192 CDD:290200 10/27 (37%)
COG5048 <179..>236 CDD:227381 17/59 (29%)
C2H2 Zn finger 183..203 CDD:275368 7/22 (32%)
C2H2 Zn finger 214..234 CDD:275368 7/20 (35%)
Klf13NP_067341.2 COG5048 <163..253 CDD:227381 30/100 (30%)
C2H2 Zn finger 170..192 CDD:275368 7/22 (32%)
C2H2 Zn finger 200..222 CDD:275368 7/22 (32%)
C2H2 Zn finger 230..250 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5334
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.