DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43313 and CG9220

Sequence 1:NP_001285184.1 Gene:CG43313 FlyBaseID:FBgn0263005 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001285280.1 Gene:CG9220 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster

Alignment Length:878 Identity:181/879 (21%)
Similarity:333/879 (38%) Gaps:221/879 (25%)


  Fly    43 ENLLIERFGQEFEPHLNLINKPLAAKKPVKNV-IRPRYYSSE---LGIREK----------LFIG 93
            :.|:|..||......:..:.|...|.:.||.. :||....:.   :|:|::          :|:|
  Fly    10 KTLIIGFFGIALGLCIGTMLKNYLALEIVKRCSLRPTNLKTPADIIGLRDEDTIQNSQRNLVFVG 74

  Fly    94 VMTSQEHINTFATAFNRTTAHLV-NKIKFF----IYADSVKTNYKLKNIVGFTDTR--ESRRPFH 151
            |||::..:...|.|...|....| .::.||    .|:|.:.. ..|||:    |.|  ..::.|.
  Fly    75 VMTAKSFLEGRARAVYDTWGKEVPGRMAFFSSEGSYSDDLPV-VGLKNV----DDRYPPQKKSFM 134

  Fly   152 VVKYIADNYLDEYDYFLLVPDTVYVDARKLVKLLYHMSITFDLYMGGARIGLDPSGGGASADGQS 216
            ::.|:.::|:|.:::|:...|.||::..||.:.|..:..:...::|.|..|              
  Fly   135 MLYYMYEHYIDRFEWFIRADDDVYMEPDKLERFLRSIDSSKPQFIGQAGKG-------------- 185

  Fly   217 NEPPANEEEAPGAS---DRNYCSLEAGILLSSSVIRKMRNNLERCVRIGSTSDHSVNIGRCVKYA 278
                 |.||....|   |.|:|....|::|||..:|::..::..|::...::...|.:||||:  
  Fly   186 -----NSEEFGLLSLEFDENFCMGGPGVILSSETLRRVAPHIPSCLKNLYSTHEDVEVGRCVQ-- 243

  Fly   279 SRVAGCQESFQGMRQFSYALDAPGRRHREFSELAKEEAFRNASTVYPVQTPEDFYRLHAYYSKHH 343
             :.||...::....|:....::.||  ..::...|.:...||.|::|::.....||||:|.....
  Fly   244 -KFAGIPCTWNYEMQYILRHNSSGR--NAYTGKLKRKEIHNAITLHPIKQAPLMYRLHSYVQGLK 305

  Fly   344 LEKVQERGYALEQKSYRIANGSISNKILEIRWP--------------------------LGVPP- 381
            .|::::....|.:...|:|      |.||:  |                          ||:.| 
  Fly   306 AEEMRQESLLLHRDIKRMA------KYLEV--PDESTYMLPSVSPESDSTKRHFQDHNILGISPE 362

  Fly   382 --PSAPETRHDILTWQLLNGTHNFLPNGNAEHAVATLSRIEAQD-FAKVLEIALQYAALKHPRLS 443
              ...|.:..|:|.|..:..:.....:.|.:..:.:..|...:| ..:|:|....|:..:...:.
  Fly   363 LNKFVPASTDDLLDWSFIARSLYSASSANPKQKIDSAMREGLEDAITEVMENINNYSRQRGRVIE 427

  Fly   444 YHSLHSAYRKFDATRGMDYQLHLNLQEGSGRSRRLVIKSFEVVKPLGR------------VEVVP 496
            :..|...|.:.||..|.|..|.|.|.....|.:::.:       |:.|            |:.|.
  Fly   428 FRELLYGYHRLDALHGQDMILDLLLIYKKYRGKKMTV-------PVRRHLYVQRAFTGIFVKEVD 485

  Fly   497 SPYVTESTRIAMLVPAFEH---------QVPDALL----------------------FVEQYERI 530
            ..:...:.:.::|...|::         .:|..||                      |:..|||:
  Fly   486 EDFYNVTLQQSLLGSLFQNGMARLSSHFTMPSGLLSPTQDKIVFVLPIAGRLGTFERFLRTYERV 550

  Fly   531 CMQNQDNTFLLLIFMYRLESPSKGDEDPFKALKTLALDLSSKYKTDGSRIAWVSIRLPEQLSEPV 595
            |::.:.:..||::..        |..|.......|..||.:::             :.:|:    
  Fly   551 CVRGEQHCDLLVVIF--------GSPDELGDHLQLLHDLHARH-------------VYQQV---- 590

  Fly   596 DPQSWLLHASMYGPRQLLSLVVADLALPKLGLESLVLLATPGMVFKADFLNRVRMNTIQGFQVYA 660
               :|:..:|.:.....|.:......:.:   |.::|.....|||:.:.|.||||:|.:|.|||.
  Fly   591 ---NWIQRSSAFSRGVALDVAARSSYIRQ---EDIILFIDVDMVFEVETLQRVRMHTQRGKQVYL 649

  Fly   661 PIGFQMY-PCRWAHFC----RECDTCDVSQSSGYFDRHNHDVIAFYSRDYVQARKLLHPQGLPII 720
            ||.|..| |.|.:...    .|.:|..:....|||.:....:.|.|..|.:              
  Fly   650 PIVFSQYDPQRRSGDAGGSEDEGETPRIDDERGYFRQFGFGICAIYKSDIL-------------- 700

  Fly   721 RSDLDIDQLLLQPGEETRPPGVESILDMFVAAQHSVHILRGVEPNLRFGQDVRNHLARGGTLPQS 785
              |.||:..    .::....|:|.:              :.:|..:|.|...|..||....|...
  Fly   701 --DEDINGF----DKDITGWGLEDV--------------KFLEKIVRVGTRQRGFLANTAELAMD 745

  Fly   786 VPERCGREQCIHLASRKQIGDAIIRYEDKSILH 818
            ..|  ..||...|        ::.|..|.:::|
  Fly   746 YNE--AAEQWRRL--------SVFRAPDPTLVH 768

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43313NP_001285184.1 CHGN 254..804 CDD:283361 122/628 (19%)
CG9220NP_001285280.1 Galactosyl_T 71..>251 CDD:304462 52/207 (25%)
CHGN 221..799 CDD:283361 125/644 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87717592
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12369
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.