DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lic and MKK4

Sequence 1:NP_477162.1 Gene:lic FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_175577.1 Gene:MKK4 AraportID:AT1G51660 Length:366 Species:Arabidopsis thaliana

Alignment Length:269 Identity:89/270 (33%)
Similarity:143/270 (53%) Gaps:30/270 (11%)


  Fly    52 LGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREG 116
            :|.||.|.|.|:.|:.:..:.|:|.|........:.::..:::| :|..:.|..|..:....:.|
plant    85 IGSGAGGTVYKVIHRPSSRLYALKVIYGNHEETVRRQICREIEI-LRDVNHPNVVKCHEMFDQNG 148

  Fly   117 DVWICMEVMST-SLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILI 180
            ::.:.:|.|.. ||:..:.        .:|..|..::..::|.|.|||:: .::|||:||||:||
plant   149 EIQVLLEFMDKGSLEGAHV--------WKEQQLADLSRQILSGLAYLHSR-HIVHRDIKPSNLLI 204

  Fly   181 NRAGQVKICDFGISGYLVDSIAKTID-----AGCKPYMAPERIDPQGNPAQYD-IRSDVWSLGIG 239
            |.|..|||.|||:|..|    |:|:|     .|...||:||||:...|..:|| ...|:||||:.
plant   205 NSAKNVKIADFGVSRIL----AQTMDPCNSSVGTIAYMSPERINTDLNQGKYDGYAGDIWSLGVS 265

  Fly   240 MIEMATGRYPY-----DNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARPNYE 299
            ::|...||:|:     .:|.:   .:..:....||..| .|.||||..||:.|||:|...|.:..
plant   266 ILEFYLGRFPFPVSRQGDWAS---LMCAICMSQPPEAP-ATASPEFRHFISCCLQREPGKRRSAM 326

  Fly   300 QLLKHSFIV 308
            |||:|.||:
plant   327 QLLQHPFIL 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 89/270 (33%)
S_TKc 47..307 CDD:214567 88/267 (33%)
MKK4NP_175577.1 PLN00034 1..350 CDD:215036 89/270 (33%)
PKc_MAPKK_plant_like 77..334 CDD:132954 88/267 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D688282at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24361
Phylome 00.000 Not matched by this tool.
33.120

Return to query results.
Submit another query.