DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and zgc:152938

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:251 Identity:49/251 - (19%)
Similarity:94/251 - (37%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLK---LART 80
            :..|.::..|::..|..|...:..:..||::|..|...|.:.:.:|:.:|.:::|..:   ....
Zfish    61 ISLVSDRRELFDQNHIDYKHIDKREALWQEIAEKIGFHVDDVKTKWKNLRDTYIRKKREDQCTGE 125

  Fly    81 QTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEV-VAAEEEAKVSDGE 144
            ||.:.|:.:...|.::||...::.|..|             ::..:..||| ..:|.|..:|   
Zfish   126 QTPKKKKTWKFMKMMEFLATSSEQRRVH-------------SSVKESADEVGDGSESEKSLS--- 174

  Fly   145 MPLDVQVSEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSLVSVPAAALG 209
            :.::..||.|..:.|.::.:...|.....:..:.|...|......:.:||....||..:..|.:.
Zfish   175 ISVESAVSSEPVQANSKKRKRSVTPDFVEKYLAAKEVRDREREECRKQRMEDDISLFLMSLAPVI 239

  Fly   210 NHL---------------------GWSDLTQWFKGHGSGHHKLTTTTTTPTSPPPP 244
            ..|                     |.||.:|    ..|..|...:....||...||
Zfish   240 RRLPPSKQSSVKMRFHQVLHEVEYGLSDASQ----PPSAQHCPESNHRAPTPDTPP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 18/86 (21%)
BESS 267..301 CDD:281011
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 13/66 (20%)
BESS 226..260 CDD:281011 4/33 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.