DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and zgc:152938

DIOPT Version :10

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:251 Identity:49/251 - (19%)
Similarity:94/251 - (37%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLK---LART 80
            :..|.::..|::..|..|...:..:..||::|..|...|.:.:.:|:.:|.:::|..:   ....
Zfish    61 ISLVSDRRELFDQNHIDYKHIDKREALWQEIAEKIGFHVDDVKTKWKNLRDTYIRKKREDQCTGE 125

  Fly    81 QTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEV-VAAEEEAKVSDGE 144
            ||.:.|:.:...|.::||...::.|..|             ::..:..||| ..:|.|..:|   
Zfish   126 QTPKKKKTWKFMKMMEFLATSSEQRRVH-------------SSVKESADEVGDGSESEKSLS--- 174

  Fly   145 MPLDVQVSEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSLVSVPAAALG 209
            :.::..||.|..:.|.::.:...|.....:..:.|...|......:.:||....||..:..|.:.
Zfish   175 ISVESAVSSEPVQANSKKRKRSVTPDFVEKYLAAKEVRDREREECRKQRMEDDISLFLMSLAPVI 239

  Fly   210 NHL---------------------GWSDLTQWFKGHGSGHHKLTTTTTTPTSPPPP 244
            ..|                     |.||.:|    ..|..|...:....||...||
Zfish   240 RRLPPSKQSSVKMRFHQVLHEVEYGLSDASQ----PPSAQHCPESNHRAPTPDTPP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 18/86 (21%)
BESS 267..301 CDD:460758
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:463144 13/66 (20%)
BESS 226..260 CDD:460758 4/33 (12%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.