DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and AgaP_AGAP004174

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_001688419.2 Gene:AgaP_AGAP004174 / 5667711 VectorBaseID:AGAP004174 Length:326 Species:Anopheles gambiae


Alignment Length:273 Identity:57/273 - (20%)
Similarity:95/273 - (34%) Gaps:79/273 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSFLRSLKLARTQ 81
            :.:|..:..|.|::..||.|..|....:|..::.:|::..      |..|.....||.::..|||
Mosquito    12 QLIQSYKKHPVLYDMRHPRYYNKTFRGKALSEIVDDVQQV------RPDTSMKDVLRKIQTMRTQ 70

  Fly    82 TGRGKRK----------------YYLSKYLQFLVPFTKSRSCHKQLPGM---------------- 114
            .|:...|                :|.|  |.||....|.||. ..:|.|                
Mosquito    71 FGQELTKTRRHSMNGSMYQPTVWWYES--LSFLQNHIKHRSV-DAVPTMENDGWKSEHDDSSSYN 132

  Fly   115 --VLRKPGQAATAQQEDEVVAAEEEAKVSDGEMPLDVQVSEEEHRRNQEQDREQPTACLPLRLHS 177
              ::|..|.:.:..:.:.|    |....:||     ::...|.|......|.:...|.....:.|
Mosquito   133 VSIVRNRGGSGSPSEINNV----EYEHSTDG-----MEYETEVHYEINSIDMKDIKALELKPIVS 188

  Fly   178 IKVEHDSSNANQQL---ERMVSQQSLVSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTTTPT 239
            ..|...|....:.|   :|.|::.|.||:..|.:.|                 ||       :||
Mosquito   189 ASVSAGSKRDARYLDRSDRKVARTSQVSLKDAKIVN-----------------HH-------SPT 229

  Fly   240 SPPPPPQPATSAL 252
            ..|.|.:|:|:.:
Mosquito   230 PEPVPAEPSTATV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 23/101 (23%)
BESS 267..301 CDD:281011
AgaP_AGAP004174XP_001688419.2 MADF_DNA_bdg 13..101 CDD:287510 21/95 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.