DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4404 and AgaP_AGAP012073

DIOPT Version :9

Sequence 1:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_001238321.1 Gene:AgaP_AGAP012073 / 4577480 VectorBaseID:AGAP012073 Length:179 Species:Anopheles gambiae


Alignment Length:130 Identity:32/130 - (24%)
Similarity:59/130 - (45%) Gaps:15/130 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRFVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDIKDTVRNCRERWRTIRSSF--LRSLKLA 78
            :.|:..||:.|.|||..||.|...:.::..||.||:::...|.:|:::|.::|:.|  ||...|.
Mosquito    42 LEFIAVVESHPLLWNKAHPDYGNVKRLEDTWQLVADEMDLDVEDCKDKWNSLRAQFRRLRRKILQ 106

  Fly    79 RTQTGRGKRKYYLSKY-----LQFLVPFTKSRSCHKQLPGMVLRKP--------GQAATAQQEDE 130
            .::...|..:.|...:     :.||....:.....|:.......||        .:.||.::.|:
Mosquito   107 SSEDATGSDQIYQPSWYAYDAMTFLTDVIQHGKAKKRRLSSPRPKPEPQSNSNAPRTATVRKSDD 171

  Fly   131  130
            Mosquito   172  171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4404NP_572838.2 MADF 17..103 CDD:214738 26/92 (28%)
BESS 267..301 CDD:281011
AgaP_AGAP012073XP_001238321.1 MADF_DNA_bdg 44..131 CDD:287510 24/86 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.